PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00442.1.g00230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 301aa    MW: 33624.7 Da    PI: 8.4806
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00442.1.g00230.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.2e-1676123148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g W++eEde+lv  ++++G  +W++I++  g+ R++k+c++rw++yl
  Zmw_sc00442.1.g00230.1.am.mk  76 KGLWSPEEDERLVSHIARFGVSCWSSIPELTGLQRCGKSCRLRWLNYL 123
                                   678*******************************************97 PP

2Myb_DNA-binding47.83.2e-15129171145
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   rgr++++E++l++ ++k lG+  W+ Ia++++ gR+++++k++w+
  Zmw_sc00442.1.g00230.1.am.mk 129 RGRFSQQEEDLIIALHKTLGNS-WSQIAARLP-GRSDNEIKNFWN 171
                                   89******************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2268126IPR009057Homeodomain-like
PROSITE profilePS5129416.98571123IPR017930Myb domain
SuperFamilySSF466891.31E-2774170IPR009057Homeodomain-like
SMARTSM007179.6E-1275125IPR001005SANT/Myb domain
PfamPF002492.1E-1476123IPR001005SANT/Myb domain
CDDcd001678.11E-1079123No hitNo description
PROSITE profilePS5129423.981124178IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-25127178IPR009057Homeodomain-like
SMARTSM007174.3E-15128176IPR001005SANT/Myb domain
PfamPF002499.8E-14129171IPR001005SANT/Myb domain
CDDcd001671.03E-9131171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MSGSFDPSNR RLSKMDVWDG FLGLKLIKHD YWMEGTRLET TYRSVAAFAM GASTAARAYQ  60
MGRVRPCCSP EKKLRKGLWS PEEDERLVSH IARFGVSCWS SIPELTGLQR CGKSCRLRWL  120
NYLRPDLKRG RFSQQEEDLI IALHKTLGNS WSQIAARLPG RSDNEIKNFW NARLRKKLRQ  180
KEASSKDHVA SRSRNHREDE RKEPPPAMFN PLLPRDEDHI TCSGAATSSC DESSAAGSAA  240
AAKLQMPSAA SSASASTEAA GDSQDDFLRA MVEDASYLFG DFYLDGSQDG LSSFWEGHAF  300
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-286317816128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172178RLRKKLR
2173179LRKKLRQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968333.11e-109PREDICTED: transcription factor MYB82-like
TrEMBLK3XKX71e-109K3XKX7_SETIT; Uncharacterized protein
STRINGSi002550m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144481725